Protein Info for MIT1002_02925 in Alteromonas macleodii MIT1002

Annotation: Regulatory protein BlaI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 PF03965: Penicillinase_R" amino acids 10 to 123 (114 residues), 123.4 bits, see alignment E=3e-40

Best Hits

Swiss-Prot: 36% identical to BLAI_BACLI: Penicillinase repressor (blaI) from Bacillus licheniformis

KEGG orthology group: K07737, putative transcriptional regulator (inferred from 92% identity to amc:MADE_00935)

Predicted SEED Role

"Beta-lactamase repressor BlaI" in subsystem Beta-lactamase or Methicillin resistance in Staphylococci or Tn552

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (130 amino acids)

>MIT1002_02925 Regulatory protein BlaI (Alteromonas macleodii MIT1002)
MSKMSDKPEISNAEFEVLDVLWDDHPATSNEVIARLNDKKDWHEKTVKTLLGRLVKKEVL
GFEKQQRQYLYYPLIAKEDYTKKETTSFVSRLFKGKIAPMVAGFANQNSLSKQDVDELKA
LIKKWEENND