Protein Info for MIT1002_02913 in Alteromonas macleodii MIT1002

Annotation: Redox-sensitive transcriptional activator SoxR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 TIGR01950: redox-sensitive transcriptional activator SoxR" amino acids 7 to 146 (140 residues), 167.1 bits, see alignment E=1e-53 PF00376: MerR" amino acids 8 to 43 (36 residues), 34.9 bits, see alignment 1.6e-12 PF13411: MerR_1" amino acids 8 to 73 (66 residues), 43.1 bits, see alignment E=5.7e-15 PF09278: MerR-DNA-bind" amino acids 49 to 114 (66 residues), 58.6 bits, see alignment E=1.1e-19

Best Hits

Swiss-Prot: 50% identical to SOXR_CHRVO: HTH-type transcriptional activator SoxR homolog (soxR) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K13639, MerR family transcriptional regulator, redox-sensitive transcriptional activator SoxR (inferred from 75% identity to gag:Glaag_2747)

Predicted SEED Role

"Redox-sensitive transcriptional activator SoxR" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (158 amino acids)

>MIT1002_02913 Redox-sensitive transcriptional activator SoxR (Alteromonas macleodii MIT1002)
MAPEPMVSIGFIAKRTGNAVSLIRYYANEGLIPSVRTSGGNRAFPRSVIRRVSFILIAQN
MGYSLAEIKSLLSTLPDNRTPTQADWAKLSTVFNQHIEAKIAALTSLKTSLEGCIGCGCL
SLDRCRLYNTDDKVAAQGSGAQLLDENVQYQFLVSHKK