Protein Info for MIT1002_02810 in Alteromonas macleodii MIT1002

Annotation: preprotein translocase subunit SecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 137 to 154 (18 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 237 to 255 (19 residues), see Phobius details amino acids 266 to 290 (25 residues), see Phobius details PF07549: Sec_GG" amino acids 32 to 58 (27 residues), 32.4 bits, see alignment (E = 4.9e-12) TIGR00966: protein-export membrane protein SecF" amino acids 39 to 283 (245 residues), 280.9 bits, see alignment E=1.1e-87 PF02355: SecD_SecF_C" amino acids 109 to 290 (182 residues), 231.6 bits, see alignment E=5.2e-73 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 115 to 280 (166 residues), 183 bits, see alignment E=6.8e-58

Best Hits

Swiss-Prot: 64% identical to SECF_VIBAL: Protein translocase subunit SecF (secF) from Vibrio alginolyticus

KEGG orthology group: K03074, preprotein translocase subunit SecF (inferred from 97% identity to amc:MADE_01348)

MetaCyc: 52% identical to Sec translocon accessory complex subunit SecF (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Protein-export membrane protein SecF (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>MIT1002_02810 preprotein translocase subunit SecF (Alteromonas macleodii MIT1002)
MQLLKLSDTVNFMRLRIPAMVLSTVLILGSFVSLGVNSLNWGLDFTGGTLIEVGYEDAAN
LEGIRAQLNEANFEDAIVQNFGSSQDVLIRIAPRDGVKAVTIGEQVLAALRADGTEVDMR
RIEFVGPNVGEELTEQGGLAMLVALLCILVYVAMRFEWRFALGSVSALAHDVILTLGLFS
VLQIEFDLTVLAAVLAVIGYSLNDTIVVCDRIRENFRKIRKGEPVEIINISLTQTLNRTI
ITSLTTVLVLVALFYKGGALIHGFATALLFGVVVGTYSSVYIASSVALALGISKEDLMPP
QVEKEGADLDPMP