Protein Info for MIT1002_02802 in Alteromonas macleodii MIT1002
Annotation: HTH-type transcriptional regulator IscR
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 77% identical to ISCR_YERE8: HTH-type transcriptional regulator IscR (iscR) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
KEGG orthology group: K13643, Rrf2 family transcriptional regulator, iron-sulfur cluster assembly transcription factor (inferred from 99% identity to amc:MADE_01355)Predicted SEED Role
"Iron-sulfur cluster regulator IscR" in subsystem Rrf2 family transcriptional regulators
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (161 amino acids)
>MIT1002_02802 HTH-type transcriptional regulator IscR (Alteromonas macleodii MIT1002) MKLTSKGRYAVTAMLDVALHSKRGPVPLADISERQEISLSYLEQLFSRLRKEQLVDSVRG PGGGYLLGREASKIAIGEVIRAVDESIDATRCQGQADCQGGDRCLTHSLWQDLSDRIAAF LNSITLGELMAKRDVQEVADRQDGNASLRHITKDIEVSIQL