Protein Info for MIT1002_02785 in Alteromonas macleodii MIT1002

Annotation: Outer membrane protein assembly factor BamB precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details TIGR03300: outer membrane assembly lipoprotein YfgL" amino acids 18 to 415 (398 residues), 397.9 bits, see alignment E=1.8e-123 PF13360: PQQ_2" amino acids 57 to 111 (55 residues), 22.8 bits, see alignment 1e-08 amino acids 123 to 340 (218 residues), 175.9 bits, see alignment E=1.6e-55 PF01011: PQQ" amino acids 70 to 163 (94 residues), 37.8 bits, see alignment E=1.5e-13

Best Hits

Swiss-Prot: 80% identical to BAMB_ALTNA: Outer membrane protein assembly factor BamB (bamB) from Alteromonas naphthalenivorans

KEGG orthology group: None (inferred from 92% identity to amc:MADE_02978)

Predicted SEED Role

"Outer membrane protein YfgL, lipoprotein component of the protein assembly complex (forms a complex with YaeT, YfiO, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>MIT1002_02785 Outer membrane protein assembly factor BamB precursor (Alteromonas macleodii MIT1002)
MFHNTCGRKGRFARTIGMALAVSITMSGCSTISDWFADDEELEIRRLKPIEAKFTPKLVW
DRDIGDGVNHYFSRLRPVYAYDKLYAADRHGAVVAMDPESGKVLWEKDFAQFRSEGMLSS
VTNLWRSGETARIGGIAVADRHVFIGTENGYVAAMDAETGELVWDASVPGEILAAPAADE
GILVVNTGAGSLLGFNTRTGEQLWRHEGDTPPLTLRGISGPIASNGGAIIGTPTGKIQVN
LIETGVLAWETVIATPSGATELERIVDIDTTPVLFGGTVYTVSYNGTLAAVELRSGRVIW
KREYASFRNLNIDGNKIFVVDNNSNVYALDRRNGVELWSQGSLKHRSLTAATPVGDHVVV
GDNWGFLHWIEQETGEVVARLDVGGDDEDDSIYAAPLKVDDKIIAVTRNGVIASVQVPK