Protein Info for MIT1002_02777 in Alteromonas macleodii MIT1002

Annotation: Ribose and galactose chemoreceptor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 187 to 208 (22 residues), see Phobius details PF00015: MCPsignal" amino acids 341 to 504 (164 residues), 136.6 bits, see alignment E=4.1e-44

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 91% identity to amc:MADE_02969)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (540 amino acids)

>MIT1002_02777 Ribose and galactose chemoreceptor protein (Alteromonas macleodii MIT1002)
MFNYTSISRLVMTPVLASFLILVLLNGASILKSFSLLNSFDELENTLVQSERDVNNTLSA
FKTQVQEWKNVLLRGHKREDREKYWERFKQREADITRQFDLMLSSSVISESVKSDIRQFQ
KAHAVMAEKYREGYDAFINSGFDPKVGDSFVRGIDREPAKLLSGIAAEIAADSANAIAEL
KANTRTMLWIILLAAIALSVLSVAYVIARLRSQVIKPTKQVAACISNLAHSRYDYALTYS
SDHELGMLAESARALQNKLKDSVAQLQQAETEMEKAFGTLGNVSQSIMEGANGQRDASRS
LDSSTDKLKEIVQNLVAITDQVAVATNNSEKNVASCYATFESANAGFKQLAKTVTESSNI
VSELQSRSTNILKVVNVINEIADQTNLLALNAAIEAARAGEHGRGFAVVADEVRALAAKT
QQSTKEINDILSSFEAEAKGAVAAMSSGKQLSDTNAAEAATALETLNNVVRDIQETASVV
VALNEAADEQEAVLQQVETIISNVVTSSEKYHQLAQRDDMSRSMKSMSENVEKVVNSLTR