Protein Info for MIT1002_02746 in Alteromonas macleodii MIT1002

Annotation: putative oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00106: adh_short" amino acids 6 to 198 (193 residues), 136 bits, see alignment E=1.7e-43 PF08659: KR" amino acids 7 to 169 (163 residues), 43.1 bits, see alignment E=6.8e-15 PF13561: adh_short_C2" amino acids 11 to 202 (192 residues), 93.6 bits, see alignment E=2.2e-30

Best Hits

Swiss-Prot: 48% identical to Y945_MYCTU: Uncharacterized oxidoreductase Rv0945 (Rv0945) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 82% identity to alt:ambt_04120)

Predicted SEED Role

"Short chain dehydrogenase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>MIT1002_02746 putative oxidoreductase (Alteromonas macleodii MIT1002)
MTTRRNILITGASSGLGKGMAIEFAKQGCNLALCARRFENLEKLKDELHSINPNIDVYIR
SLDVNDHDAVFEVFDAFKADMGTLDRVIVNAGMGKGASIGTGYFHANKQTAVTNFVSALA
QCEAAMAIFRAQNSGHLVTISSISAVRGFRRAMTVYAATKAGLTSMTEGIRMDVMNTPIN
VTCIHPGFIRSEINEKVEKVPFIVDTDVGCRAMVNAINKEKANAFVPSWPWAILHWIMRI
APASSIRKMS