Protein Info for MIT1002_02653 in Alteromonas macleodii MIT1002

Annotation: Nucleoid-associated protein YbaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 TIGR00103: DNA-binding protein, YbaB/EbfC family" amino acids 3 to 104 (102 residues), 119.8 bits, see alignment E=2.5e-39 PF02575: YbaB_DNA_bd" amino acids 10 to 98 (89 residues), 121.5 bits, see alignment E=7e-40

Best Hits

Swiss-Prot: 96% identical to Y1098_ALTMD: Nucleoid-associated protein MADE_1013280 (MADE_1013280) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K09747, hypothetical protein (inferred from 92% identity to alt:ambt_04555)

Predicted SEED Role

"FIG000557: hypothetical protein co-occurring with RecR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>MIT1002_02653 Nucleoid-associated protein YbaB (Alteromonas macleodii MIT1002)
MFKGGMGNIMKQAQQMQERMQKAQDDLAKIEVTGEAGAGMVKVTMTCNHNVRRVDIDESL
MDDDKDMVEDLVAAAFNDAVRRVQETSKEKMGDVTGGMPLPPGFKMPF