Protein Info for MIT1002_02590 in Alteromonas macleodii MIT1002

Annotation: Outer membrane protein slp precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR00752: outer membrane lipoprotein, Slp family" amino acids 7 to 173 (167 residues), 100 bits, see alignment E=5.3e-33 PF03843: Slp" amino acids 14 to 163 (150 residues), 140.5 bits, see alignment E=1.4e-45

Best Hits

KEGG orthology group: K07285, outer membrane lipoprotein (inferred from 88% identity to amc:MADE_01135)

Predicted SEED Role

"Starvation lipoprotein Slp paralog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>MIT1002_02590 Outer membrane protein slp precursor (Alteromonas macleodii MIT1002)
MSRYLVLLTVFLFAGCTIVPDSIEVPEGTQLVSYSKAVTSGANAQGQKARWGGMIVGVEN
KPNKTFIELAHFPLNHYGKPSTNGETSGRFKVQIDGFVDPIVFEEGRAATFLGTVTAPTA
GMVGEQPYIYPTIIADDYHMWRKQEVYDVNTYFFNYHTGWYSPFYRFNGPWMYPHFNRTR
VIRYENAPSKATLPSKSKSTRSKTKATIQPARQDKAK