Protein Info for MIT1002_02589 in Alteromonas macleodii MIT1002

Annotation: Tropinesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 transmembrane" amino acids 92 to 110 (19 residues), see Phobius details PF12146: Hydrolase_4" amino acids 23 to 222 (200 residues), 55.2 bits, see alignment E=1.4e-18 PF00561: Abhydrolase_1" amino acids 24 to 138 (115 residues), 72.7 bits, see alignment E=7.9e-24 PF12697: Abhydrolase_6" amino acids 26 to 146 (121 residues), 48.3 bits, see alignment E=4.2e-16 PF01764: Lipase_3" amino acids 72 to 114 (43 residues), 23.2 bits, see alignment 1.1e-08

Best Hits

KEGG orthology group: None (inferred from 89% identity to amc:MADE_01136)

Predicted SEED Role

"Predicted hydrolase/acyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>MIT1002_02589 Tropinesterase (Alteromonas macleodii MIT1002)
MIETEFNIGALHLAALDNQGAGKVVLGLHGYLDNAESLRLLAPYLQTHRFIALDLAGHGR
SGHRALGAHYNQADYLQDLYALIESQEWEEVILLGHSLGGILASLFAALFPEKVTAVISI
DACGPLTETEETTAAQMRDAIMSRHAKSRNKLRIVDLDDAVKARCKVSDIPAEHARSILS
RNLTQDAGGHCFWSSDPKLRTKSTLRLTEKQAESLMRAIVCPILFIGASNSFKNLETVFP
NRKGWFLNAQYEQLVGGHHIHMENTDDVGVLIRHFVEQL