Protein Info for MIT1002_02586 in Alteromonas macleodii MIT1002

Annotation: YcgL domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 98 PF05166: YcgL" amino acids 3 to 75 (73 residues), 104.3 bits, see alignment E=1.7e-34

Best Hits

Swiss-Prot: 88% identical to Y1139_ALTMD: YcgL domain-containing protein MADE_1012200 (MADE_1012200) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K09902, hypothetical protein (inferred from 88% identity to amc:MADE_01139)

Predicted SEED Role

"Protein YcgL"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (98 amino acids)

>MIT1002_02586 YcgL domain protein (Alteromonas macleodii MIT1002)
MLCAVYKTRKKDGMYLYVPKKDHFEDVPEPLMAKFGRPELVTIIALEKREKLGLVDKQKL
IDELNEKGFYLQMPPKEDNLLEQHRESLGLSKTPDKKF