Protein Info for MIT1002_02549 in Alteromonas macleodii MIT1002

Annotation: Spermine/spermidine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00583: Acetyltransf_1
  • amino acids 15 to 127 (113 residues), 43.7 bits, E=4.7e-15
• PF13673: Acetyltransf_10
  • amino acids 35 to 132 (98 residues), 30.9 bits, E=3.7e-11
• PF13508: Acetyltransf_7
  • amino acids 49 to 129 (81 residues), 36.8 bits, E=6.2e-13

Best Hits

KEGG orthology group: K00657, diamine N-acetyltransferase [EC: 2.3.1.57] (inferred from 94% identity to amc:MADE_01186)

Predicted SEED Role

"acetyltransferase, GNAT family"

MetaCyc Pathways

• putrescine degradation III (2/4 steps found)
• spermine and spermidine degradation I (2/5 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.57

Protein Sequence (145 amino acids)

>MIT1002_02549 Spermine/spermidine acetyltransferase (Alteromonas macleodii MIT1002)
MKISLEEINKSNYEQVCDLDVADDQQAFVACNMWSLVESFYNENHTCKAIYCNDQPVGFL
MWVQETPTKVSIWRFMIDKSHQNNGIGRVALSQAITLIKQTSELRQIEICYNPKNPVTKA
FYSSFGFEEVGLDEDGEDMLAVIAI