Protein Info for MIT1002_02514 in Alteromonas macleodii MIT1002
Annotation: Zinc-type alcohol dehydrogenase-like protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 40% identical to ZDH1_STAEQ: Zinc-type alcohol dehydrogenase-like protein SERP1785 (SERP1785) from Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
KEGG orthology group: None (inferred from 90% identity to amc:MADE_01966)Predicted SEED Role
"Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase" (EC 1.1.1.-)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Aminosugars metabolism
- Ascorbate and aldarate metabolism
- Benzoate degradation via CoA ligation
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of type II polyketide products
- Biosynthesis of unsaturated fatty acids
- Bisphenol A degradation
- Butanoate metabolism
- C21-Steroid hormone metabolism
- Fructose and mannose metabolism
- Glycine, serine and threonine metabolism
- Insect hormone biosynthesis
- Linoleic acid metabolism
- Nucleotide sugars metabolism
- Polyketide sugar unit biosynthesis
- Retinol metabolism
- Tetrachloroethene degradation
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.-
Use Curated BLAST to search for 1.1.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (338 amino acids)
>MIT1002_02514 Zinc-type alcohol dehydrogenase-like protein (Alteromonas macleodii MIT1002) MMKAIGYTHSRGINEPNALVDIDIEKPSASGRDLLVKISAIAVNPVDYKIRHRVNPNGGD PKILGWDAVGEIVDIGADVTEFAVGDRVYYAGDLTRVGSNAEFQLVDERIVGKAPKSLSD SDAAALPLTTITAYELLFDHLALRQQSEKSDEVVLVVGAAGGVGSIMLQLLKVLTGATVI ATASRESSKSWVQELGADYVVDHSKPMAEQIKALNIGEVTHVASLNNTHQYIESFVEVMK PKGKLALIDDPESLDVAKLKQKSLSLHWEFMFTRSMFETDDMAEQSRLLTHVAGLIDEGK IKTTVGKHLGKINAANLIEAHKTLEEGSAIGKLVLEGF