Protein Info for MIT1002_02500 in Alteromonas macleodii MIT1002

Annotation: Cysteine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 TIGR00435: cysteine--tRNA ligase" amino acids 2 to 459 (458 residues), 600.8 bits, see alignment E=1.1e-184 PF01406: tRNA-synt_1e" amino acids 15 to 313 (299 residues), 460.8 bits, see alignment E=6.7e-142 PF09334: tRNA-synt_1g" amino acids 36 to 139 (104 residues), 31.6 bits, see alignment E=2.4e-11 amino acids 252 to 311 (60 residues), 26.9 bits, see alignment E=6.4e-10 PF00133: tRNA-synt_1" amino acids 222 to 303 (82 residues), 31.2 bits, see alignment E=3.1e-11 PF09190: DALR_2" amino acids 342 to 395 (54 residues), 65.4 bits, see alignment 1.7e-21 PF23493: CysS_C" amino acids 410 to 458 (49 residues), 41.8 bits, see alignment 2.9e-14

Best Hits

Swiss-Prot: 65% identical to SYC_VIBPA: Cysteine--tRNA ligase (cysS) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K01883, cysteinyl-tRNA synthetase [EC: 6.1.1.16] (inferred from 98% identity to amc:MADE_01977)

Predicted SEED Role

"Cysteinyl-tRNA synthetase (EC 6.1.1.16)" in subsystem Conserved gene cluster possibly involved in RNA metabolism (EC 6.1.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>MIT1002_02500 Cysteine--tRNA ligase (Alteromonas macleodii MIT1002)
MLHLYNTRTREKAKFVPLQEGKVGLYVCGITVYDLSHMGHARTYLSFDVLVRYMRHLGLD
VKYVRNITDIDDKIIARANENGESFEALTARTIAMMHEDFAAINLLEPDVEPTVSGHMDE
IIAIIQRLMDKGYAYQAKSGDVLFDVSKYEDYGKLSKQDLDQLKAGARVEVAAGKDDPLD
FVLWKTTKPGEPAWQSPWGEGRPGWHIECSAMNHKHLGAHFDIHGGGSDLTFPHHENEVA
QSCCAYDTPYVNVWMHAGMVQVNDEKMSKSLGNFFTLRDVLKEHDSETLRFFLMSAHYRS
QLSYSQDNITQAKAALERLYTALRGVEVDESTDLSYGGYLKRFEAAMNDDLNVPEAFSVL
FDVARELNRQKDNVEEAGKLAAVLKGLGAILGMLQSDPDTFLKGGEGNDDEAAEIEALIK
QRNDARASKDWAAADAARDALNAKGVVLEDGPSGTTWRKA