Protein Info for MIT1002_02494 in Alteromonas macleodii MIT1002

Annotation: Hydroxyacylglutathione hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 TIGR03413: hydroxyacylglutathione hydrolase" amino acids 12 to 263 (252 residues), 343.4 bits, see alignment E=3.4e-107 PF00753: Lactamase_B" amino acids 23 to 175 (153 residues), 55.8 bits, see alignment E=6.4e-19 PF16123: HAGH_C" amino acids 176 to 263 (88 residues), 98.4 bits, see alignment E=2.6e-32

Best Hits

Swiss-Prot: 56% identical to GLO2_ALISL: Hydroxyacylglutathione hydrolase (gloB) from Aliivibrio salmonicida (strain LFI1238)

KEGG orthology group: K01069, hydroxyacylglutathione hydrolase [EC: 3.1.2.6] (inferred from 87% identity to amc:MADE_01981)

Predicted SEED Role

"Hydroxyacylglutathione hydrolase (EC 3.1.2.6)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 3.1.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>MIT1002_02494 Hydroxyacylglutathione hydrolase (Alteromonas macleodii MIT1002)
MTAETLPSGVAIHPIPAFTDNYIWCIYNESSAIVVDPGDAEPVLAFIKAKGLTLSAVLIT
HHHRDHTGGIAKLVSAVPDLPVIGPRGNHIRGITKSVSQGDTVSLPVFKMALQVMEVPGH
TLDHIAFFGHGALFCGDTLFSAGCGRLFEGSPEQMHHSLNKLKRLPDTTKVFCTHEYTQA
NVQFALAVEPDNKALCDYAQWVAEKRAQGQPTLPSNLKEQKNINPFLRAHELSVKTAAEA
YCENNLADDVAVFAAVRRWKDEF