Protein Info for MIT1002_02482 in Alteromonas macleodii MIT1002

Annotation: DNA-invertase hin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 PF00239: Resolvase" amino acids 3 to 137 (135 residues), 129.1 bits, see alignment E=2.1e-41 PF02796: HTH_7" amino acids 139 to 173 (35 residues), 39.7 bits, see alignment 6.5e-14

Best Hits

Swiss-Prot: 48% identical to TNR2_ECOLX: Transposon Tn21 resolvase (tnpR) from Escherichia coli

KEGG orthology group: None (inferred from 54% identity to sbp:Sbal223_1811)

MetaCyc: 34% identical to e14 prophage; site-specific DNA recombinase (Escherichia coli K-12 substr. MG1655)
5.99.1.-

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>MIT1002_02482 DNA-invertase hin (Alteromonas macleodii MIT1002)
MEIGYIRVSTVEQNTARQLDGLALDKVYTDKCSGKDTDRPQLKVMLEHLREGDTVHVHDI
SRMARNVGNLLDLVESLRNRGVTLKFHKENMTFTPDKNDPMQELMLTMLGGIYQFERSMI
LERQREGIAIAKAEGKYKGRPKSIDRERVKQMLEDGISIRKIAAQLSISPSTVQAVKKEM
SS