Protein Info for MIT1002_02420 in Alteromonas macleodii MIT1002

Annotation: urea carboxylase-associated protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF09347: DUF1989
  • amino acids 4 to 168 (165 residues), 174.8 bits, E=6.2e-56

Best Hits

KEGG orthology group: K09967, hypothetical protein (inferred from 92% identity to amc:MADE_01230)

Predicted SEED Role

"Urea carboxylase-related aminomethyltransferase (EC 2.1.2.10)" in subsystem Urea decomposition (EC 2.1.2.10)

MetaCyc Pathways

• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Nitrogen metabolism
• One carbon pool by folate

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.10

Use Curated BLAST to search for 2.1.2.10

Protein Sequence (197 amino acids)

>MIT1002_02420 urea carboxylase-associated protein 1 (Alteromonas macleodii MIT1002)
MIQTIQPRSGTAFTMKKGERLKVIDPEGEQVADLYAFNEHDKNEFISSGRSLDYNESIQF
KKGSLLYSNQSNVMFEIIEDTVEDHDFLLTPCSVDTFKHFYPNEEPVPGCHGNLVAAFSE
FDIPEHHVCTTFNTFMNVEVDAKGKISVLPPKSNAGDYTIFEAKMDLIVGLTACSAGESN
NFRYKPIQFEILPAANI