Protein Info for MIT1002_02396 in Alteromonas macleodii MIT1002

Annotation: Peptide methionine sulfoxide reductase MsrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 TIGR00357: methionine-R-sulfoxide reductase" amino acids 12 to 139 (128 residues), 178 bits, see alignment E=4.4e-57 PF01641: SelR" amino acids 16 to 133 (118 residues), 176.8 bits, see alignment E=7.3e-57

Best Hits

Swiss-Prot: 89% identical to MSRB_ALTMD: Peptide methionine sulfoxide reductase MsrB (msrB) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K07305, peptide-methionine (R)-S-oxide reductase [EC: 1.8.4.12] (inferred from 89% identity to amc:MADE_01256)

MetaCyc: 54% identical to methionine sulfoxide reductase B (Escherichia coli K-12 substr. MG1655)
L-methionine (R)-S-oxide reductase. [EC: 1.8.4.14]; Peptide-methionine (R)-S-oxide reductase. [EC: 1.8.4.14, 1.8.4.12]

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)" (EC 1.8.4.12)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.12 or 1.8.4.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (142 amino acids)

>MIT1002_02396 Peptide methionine sulfoxide reductase MsrB (Alteromonas macleodii MIT1002)
MSTDKNTNSSTNEKDWKTELNDEEYYVCREAGTERPFTGVLLDEQRDGLYVCKCCEAPLF
PSDTKFDAGCGWPSFYKQLDDGNVDYREDLTHGMRRVEIFCKQCGSHLGHVFPDGPAPTG
QRYCVNSLSMTFIGEDNAKVRG