Protein Info for MIT1002_02380 in Alteromonas macleodii MIT1002

Annotation: Aerobic respiration control sensor protein ArcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 694 PF00072: Response_reg" amino acids 7 to 109 (103 residues), 49.8 bits, see alignment E=7.1e-17 amino acids 406 to 518 (113 residues), 80.4 bits, see alignment E=2.2e-26 amino acids 586 to 692 (107 residues), 68.4 bits, see alignment E=1.2e-22 PF00512: HisKA" amino acids 145 to 209 (65 residues), 67.7 bits, see alignment E=1.5e-22 PF02518: HATPase_c" amino acids 257 to 372 (116 residues), 101.9 bits, see alignment E=5.6e-33

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (694 amino acids)

>MIT1002_02380 Aerobic respiration control sensor protein ArcB (Alteromonas macleodii MIT1002)
MSEVIKILLVEDDEDDYFLTSDYLAQCESPTFELTWVTNSLDAVEALKTQSFDLCLLDYL
LGAENAIDVLGVLKSNQFNLPVVILTGQSDATVDEMVMRAGAADYLQKSEIESPRFMRTI
RYAMVRRDIENERIERNKVEQKNKAKDKFLAHLGHELRTPLTSILGYTELLIDDARNSPF
QQELSIIHSNGKHLLSLLNDLLDMSRIMAEKLELNIKEVNLSAFLTDIHSLMRLNAKDKG
LSLNVVSKTKIPEFIHTDPTRLRQVLLNLISNAVKFTDKGSITLTISLDEPSEKDSSQTL
LRFSVDDTGIGMPPDKLSNIFQPFEQIEDVMRANHGGAGLGLAICKELVTKLGGDIDVKS
RLGEGSTFTFDINPGDVSEQPRIDLELGQIQPVESSSINLNVTGRVLIVDDLREIRRLTG
HLVSQSQADISYAENGVKALEAVLQADEHNQPFDLVLMDIHMPVMNGIEALHAIRRHGQD
IPVIAVTAASRKGLRESLIREGFNDVIGKPIDRFALANLLSQYLPPGNHVTFTNVEAQVA
DMPIDKPHAPEDETAYRGLADNGQAEQKIQSTDSKGNSDQPANKHILVIEDDEDAAELLQ
LFLSHLGHTVTTQYSGAEALQAAENQRFDHILMDLTLPDYNGYDLASELKKKLPDAILTI
VSGHEADSETMTTIGINSALLKPVTKDDLASVVG