Protein Info for MIT1002_02307 in Alteromonas macleodii MIT1002

Annotation: 5'-nucleotidase YfbR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12917: YfbR-like
  • amino acids 6 to 187 (182 residues), 251.1 bits, E=9e-79
• PF13023: HD_3
  • amino acids 12 to 172 (161 residues), 71.2 bits, E=1.5e-23
• PF01966: HD
  • amino acids 32 to 142 (111 residues), 42.7 bits, E=9.9e-15

Best Hits

Swiss-Prot: 73% identical to 5DNU_ERWT9: 5'-deoxynucleotidase ETA_12010 (ETA_12010) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K08722, 5'-nucleotidase [EC: 3.1.3.5] (inferred from 100% identity to amc:MADE_01071)

MetaCyc: 70% identical to dCMP phosphohydrolase (Escherichia coli K-12 substr. MG1655)
RXN-14143 [EC: 3.1.3.89]; 3.1.3.89 [EC: 3.1.3.89]; 3.1.3.89 [EC: 3.1.3.89]; 3.1.3.89 [EC: 3.1.3.89]

Predicted SEED Role

"Nucleotidase YfbR, HD superfamily"

MetaCyc Pathways

• adenosine nucleotides degradation II (5/5 steps found)
• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• purine nucleotides degradation II (aerobic) (9/11 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• guanosine nucleotides degradation I (3/4 steps found)
• guanosine nucleotides degradation III (3/4 steps found)
• inosine 5'-phosphate degradation (3/4 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• ureide biosynthesis (5/7 steps found)
• NAD salvage pathway III (to nicotinamide riboside) (2/3 steps found)
• superpathway of purines degradation in plants (12/18 steps found)
• tunicamycin biosynthesis (2/9 steps found)
• NAD salvage (plants) (3/11 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5 or 3.1.3.89

Protein Sequence (199 amino acids)

>MIT1002_02307 5'-nucleotidase YfbR (Alteromonas macleodii MIT1002)
MSDKSHFFAHLARLKLINRWPLMHNVRTENVQEHSLQVAMVAHALALIKNKFFGGTLNPD
RIATMAIFHDVSEVLTGDLPTPVKYFNPAIKEEYKKIEKIAENKLIEMAPEAFREDYAAL
IDHHYHSEEEAFIVKAADVLCAYLKTLEELAAGNQEFKLAKKRLDKTLKEYHSEEVDYFL
TRYVPSFSLSLDEITQDDM