Protein Info for MIT1002_02195 in Alteromonas macleodii MIT1002

Annotation: Ribonucleoside-diphosphate reductase 1 subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03477: ATP-cone
  • amino acids 6 to 92 (87 residues), 52.7 bits, E=7.9e-18
• PF00317: Ribonuc_red_lgN
  • amino acids 141 to 219 (79 residues), 54.3 bits, E=1.7e-18
• TIGR02506: ribonucleoside-diphosphate reductase, alpha subunit
  • amino acids 145 to 735 (591 residues), 588 bits, E=1.1e-180
• PF02867: Ribonuc_red_lgC
  • amino acids 223 to 732 (510 residues), 456.7 bits, E=1.6e-140

Best Hits

Swiss-Prot: 82% identical to RIR1_ECOLI: Ribonucleoside-diphosphate reductase 1 subunit alpha (nrdA) from Escherichia coli (strain K12)

KEGG orthology group: K00525, ribonucleoside-diphosphate reductase alpha chain [EC: 1.17.4.1] (inferred from 99% identity to amc:MADE_02125)

MetaCyc: 82% identical to ribonucleoside-diphosphate reductase 1 subunit alpha (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Ribonucleotide reductase of class Ia (aerobic), alpha subunit (EC 1.17.4.1)" in subsystem Ribonucleotide reduction (EC 1.17.4.1)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis II (3/4 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis II (3/4 steps found)

KEGG Metabolic Maps

• Glutathione metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.17.4.1

Use Curated BLAST to search for 1.17.4.1

Protein Sequence (773 amino acids)

>MIT1002_02195 Ribonucleoside-diphosphate reductase 1 subunit alpha (Alteromonas macleodii MIT1002)
MNNNLLVTKRNGEKESIDLEKIHKVVTWAAKGLKNVSVSQVEIKAQIQFYDGINTSEIHE
TLIKSAADLISTDAPDYQYLAARLAIFHLRKKAYGQFEPPALLEHVGKMVDMGKYDKHLL
EDYTPEEFAEMDSYIDHWRDMNFSYAAVKQLEGKYLVQNRVTGEIYESAQFLYILVAACL
FANYDKATRMDYIRRFYDAASTFKLSLPTPIMAGVRTPTRQFSSCVLIETGDSLDSINAT
ASAIVKYVSQRAGIGVNAGRIRALGSPIRGGEAFHTGCIPFYKYFQTAVKSCSQGGVRGG
AATLFYPIWHMEVESLLVLKNNRGVEENRVRHLDYGVQFNKLMYQRMMKDGYISLFSPSD
VPGLYDAFFADQEKFEELYVKYENDDSIRKKQIKAMELFSLFMQERASTGRIYLQNVDHC
NTHSPFNPEVAPVRQSNLCLEIALPTKPLQHVNDENGEIALCTLSAFNLGAIKSLDEFEE
LSDLAVRALDNLLDYQDYPVPAAYNATMGRRTLGVGVINFAYYLAKNGVKYSDHSANGLV
HRTFEAMQYYLLKASNNLAKEKGACPKFNETTYSQGIMPIDSYKKDLDSVCNEPLHYDWD
ALREEIKTHGLRNSTLSALMPSETSSQISNATNGIEPPRGFISIKSSKDGVLKQVVPEYE
TLRDQYELLWDIPSNDGYLQLVGIMQKFIDQTISANTNYDPSRYEGNKVPMKLLLKDLLT
TYKLGVKTLYYHNTRDGASDTSALDAKASEPMPRQEEVVVEEDDDCAGGACKI