Protein Info for MIT1002_02194 in Alteromonas macleodii MIT1002

Annotation: 3-demethylubiquinone-9 3-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase" amino acids 8 to 227 (220 residues), 283.5 bits, see alignment E=5.2e-89 PF01209: Ubie_methyltran" amino acids 38 to 149 (112 residues), 40.7 bits, see alignment E=8.5e-14 PF05175: MTS" amino acids 48 to 119 (72 residues), 27.2 bits, see alignment E=1.3e-09 PF13489: Methyltransf_23" amino acids 49 to 198 (150 residues), 84.2 bits, see alignment E=3.8e-27 PF06325: PrmA" amino acids 49 to 151 (103 residues), 28.8 bits, see alignment E=4e-10 PF13847: Methyltransf_31" amino acids 50 to 153 (104 residues), 58.8 bits, see alignment E=2.6e-19 PF13649: Methyltransf_25" amino acids 52 to 145 (94 residues), 70.8 bits, see alignment E=6e-23 PF08241: Methyltransf_11" amino acids 53 to 149 (97 residues), 81.6 bits, see alignment E=2.3e-26 PF08242: Methyltransf_12" amino acids 53 to 147 (95 residues), 58.6 bits, see alignment E=3.9e-19

Best Hits

Swiss-Prot: 66% identical to UBIG_VIBC3: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 95% identity to amc:MADE_02124)

MetaCyc: 68% identical to bifunctional 3-demethylubiquinone-8 3-O-methyltransferase and 2-octaprenyl-6-hydroxyphenol methylase (Escherichia coli K-12 substr. MG1655)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; 2-OCTAPRENYL-6-OHPHENOL-METHY-RXN [EC: 2.1.1.64, 2.1.1.222]

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.64

Use Curated BLAST to search for 2.1.1.- or 2.1.1.222 or 2.1.1.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>MIT1002_02194 3-demethylubiquinone-9 3-methyltransferase (Alteromonas macleodii MIT1002)
MTNVDQQEINKFSELASRWWDPEGEFKPLHLINPLRLDFINQHSEGLFDKKVVDIGCGGG
ILAESMARAGATVTGLDMAEASLEVAKLHGLESGVKVDYVCSTAEAFAEANAGQFDVVTC
MEMLEHVPDPASVVLACAKLVKPGGHVFFSTLNRNLKSYLMGIVGAEYILKLVPKGTHDH
SKFIKPSELMAMTDHAGLLPRDMTGLHMDPISQGFYLSANNVDVNYLLYTVAQN