Protein Info for MIT1002_02178 in Alteromonas macleodii MIT1002

Annotation: Replication-associated recombination protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 PF05496: RuvB_N" amino acids 15 to 131 (117 residues), 45.6 bits, see alignment E=2.7e-15 PF07728: AAA_5" amino acids 48 to 151 (104 residues), 27.6 bits, see alignment E=1.1e-09 PF00004: AAA" amino acids 48 to 156 (109 residues), 65 bits, see alignment E=3.9e-21 PF16193: AAA_assoc_2" amino acids 183 to 257 (75 residues), 83.8 bits, see alignment E=3.3e-27 PF12002: MgsA_C" amino acids 258 to 421 (164 residues), 209.8 bits, see alignment E=1e-65

Best Hits

Swiss-Prot: 60% identical to RARA_HAEIN: Replication-associated recombination protein A (rarA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K07478, putative ATPase (inferred from 85% identity to alt:ambt_08460)

Predicted SEED Role

"FIG065221: Holliday junction DNA helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>MIT1002_02178 Replication-associated recombination protein A (Alteromonas macleodii MIT1002)
MTSVNQDFAPLAARMRPVTIEQYSGQEHLLGEGKPLRKMLEAGHCHSMILWGPPGTGKTT
LAELIAQYTNASVLRISAVTSGVKDIRAAMDTAEENARYNQRTLLFVDEVHRFNKSQQDA
FLPFVESGVVTFIGATTENPSFELNKALLSRVRVYVLKTLEHEALSELIDRALRDTEKGL
GDRALGIEETARNALIDLSGGDARRLLTYLELAADFTGANEITVSDVEHAVGEKVASYDN
KGDTFYDLISAFHKSVRGSDPDAALYWYARILDGGGDALYVGRRLLAIASEDIGNADPRA
MQLCINAWDTFHRVGPAEGERAIAQAAVYCALAAKSNAVYMAFNEAKALARKTSDAPVPM
HLRNAPTSLMKELGHGDGYRYAHNEPNAFAAGESYFPESLTGTRLYNPNERGLEKALKAK
REFLDSLNARSNNKR