Protein Info for MIT1002_02171 in Alteromonas macleodii MIT1002

Annotation: Sulfurtransferase TusE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 115 TIGR03342: sulfur relay protein, TusE/DsrC/DsvC family" amino acids 9 to 115 (107 residues), 160.8 bits, see alignment E=5.9e-52 PF04358: DsrC" amino acids 10 to 115 (106 residues), 144.5 bits, see alignment E=7.2e-47

Best Hits

Swiss-Prot: 67% identical to TUSE_PECAS: Sulfurtransferase TusE (tusE) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K11179, tRNA 2-thiouridine synthesizing protein E [EC: 2.8.1.-] (inferred from 96% identity to amc:MADE_02107)

MetaCyc: 65% identical to sulfur transfer protein TusE (Escherichia coli K-12 substr. MG1655)
2.8.1.-

Predicted SEED Role

"tRNA 2-thiouridine synthesizing protein E (EC 2.8.1.-)" in subsystem Sulfate reduction-associated complexes (EC 2.8.1.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (115 amino acids)

>MIT1002_02171 Sulfurtransferase TusE (Alteromonas macleodii MIT1002)
MTQETYSFNYKGQAIPTDKAGYLLDYTLWEEDMVELLAQEENIELTEAHWEVVRFVRAFY
EEYETSPAIRALVKAMANKFGPEKGNSRYLQRLFKKGPAKQATKLAGLPKPAKCL