Protein Info for MIT1002_02165 in Alteromonas macleodii MIT1002

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 transmembrane" amino acids 57 to 79 (23 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 125 to 150 (26 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details amino acids 195 to 213 (19 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 271 to 293 (23 residues), see Phobius details amino acids 354 to 373 (20 residues), see Phobius details amino acids 379 to 400 (22 residues), see Phobius details amino acids 412 to 432 (21 residues), see Phobius details amino acids 456 to 481 (26 residues), see Phobius details PF11840: DUF3360" amino acids 4 to 481 (478 residues), 601.2 bits, see alignment E=8.9e-185

Best Hits

KEGG orthology group: None (inferred from 96% identity to amc:MADE_02102)

Predicted SEED Role

"INTEGRAL MEMBRANE PROTEIN (Rhomboid family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (488 amino acids)

>MIT1002_02165 hypothetical protein (Alteromonas macleodii MIT1002)
MSQESSSYQNLHKPSSSFKSRDEYLNHELQILSPKRWRLNLPGKDYRVEWEDFVPGMAAT
IGKIVMVAAVVGAFAAPLGLSPEFVIENVRFELLIAAVLFVVLISGFLNPSANLAGTHGP
LLPLVPLIVASGGHPMALGLLIGLFGFILGITKGGSVLARLTSNGVCGGLLLYLGFIGIT
GQVKKLFAWAESFDMAYLAFVVIIATILMYAWLEHIQKRWLAIPLGAVMAAVIAFSFGAP
FEFTTSPGMPNLNPAYWWGEDTGWKLGLPDWSHFIAVLPFAVLAVSMWSPDFLGHQVFQK
LSYPKKSERAHMNIDDTMIAASSRQAVGSLLGGGNISSSWGTYIIPASIARRPIPGGALV
TGFLCVVAALWGYPMDLAIWPPVLCVALIVGVFLPLMEAGMQMTREGKTTQSAALVVISS
VLVNPVFGWSFTMLLDNLGLVGCKDRAGELGKAGRWLIPGITFLVLCTVMALIGMFPGVP
AIMETFRM