Protein Info for MIT1002_02157 in Alteromonas macleodii MIT1002

Annotation: ubiquinone/menaquinone biosynthesis methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 TIGR04345: putative 4-mercaptohistidine N1-methyltranferase" amino acids 63 to 305 (243 residues), 342.9 bits, see alignment E=4.9e-107 PF13489: Methyltransf_23" amino acids 101 to 239 (139 residues), 34.8 bits, see alignment E=3.3e-12 PF08241: Methyltransf_11" amino acids 108 to 231 (124 residues), 31.6 bits, see alignment E=5.5e-11

Best Hits

Predicted SEED Role

"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>MIT1002_02157 ubiquinone/menaquinone biosynthesis methyltransferase (Alteromonas macleodii MIT1002)
MYDDFTTPTFDNKHNLIKGGSWVSTGNEAMKDSRYAFRRHFFQHAGFRYVQGKRVIAVND
FDYESDTQVSQYSEFHYGDEYYGVPNFAKASAQFCIDAMQGRQHARALDLGCAVGRSTFE
LAKYFDHVDGIDFSARFIKTAFEMQERGEIRYNLIEEGELTSFKARKLSALGLDDSVDKV
AFAQGDACNLKPQYTGYDLIFLGNLIDRVYSPRKVLTDMATRLNKGGLLVVASPFTWLEE
YTERSEWLGGYKDENGETLSSTQALEDALGQSFKRIAEPKDIPFVIRETKRKYQHTLSEF
NVFEKIE