Protein Info for MIT1002_02153 in Alteromonas macleodii MIT1002

Annotation: Excinuclease ABC subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 605 TIGR00194: excinuclease ABC subunit C" amino acids 9 to 584 (576 residues), 696.1 bits, see alignment E=2e-213 PF01541: GIY-YIG" amino acids 17 to 92 (76 residues), 39.5 bits, see alignment E=2e-13 PF02151: UVR" amino acids 204 to 237 (34 residues), 43.9 bits, see alignment (E = 5e-15) PF22920: UvrC_RNaseH" amino acids 250 to 365 (116 residues), 116.8 bits, see alignment E=1.8e-37 PF08459: UvrC_RNaseH_dom" amino acids 382 to 537 (156 residues), 174.3 bits, see alignment E=6.4e-55 PF14520: HHH_5" amino acids 552 to 603 (52 residues), 35.6 bits, see alignment 3.8e-12 PF00633: HHH" amino acids 574 to 601 (28 residues), 24.6 bits, see alignment (E = 5.8e-09)

Best Hits

Swiss-Prot: 73% identical to UVRC_PSEA6: UvrABC system protein C (uvrC) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 89% identity to alt:ambt_08335)

MetaCyc: 59% identical to UvrABC excision nuclease subunit C (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (605 amino acids)

>MIT1002_02153 Excinuclease ABC subunit C (Alteromonas macleodii MIT1002)
MSAFDSAAFLKNLTSQPGVYRMYNSQEEVIYVGKAKNLKKRVSSYFRSNLDNAKTRSLVS
QIANMDVTVVNSETEAFLLENNFIKKYKPRYNVVMRDDKSYPFIFLSDHEHPRLSFHRGP
QKKKGEYFGPYPSAWSVRESLRSMQRIFPVRQCEDSYYRARSRPCLQYQMQRCSAPCVEG
YVSDEEYKEQVNFARLFLKGKNQQVIGGLVEKMEAASEALNFEAAARYRDQINALRKVQE
RQWVAGTQDEMDVFGFAFKGNMACIQVMFIREGQLLGSKAYFPKVPNTADEQEVFESFFL
QFYLAGNKVIPKQIVLGNTLTDEDAIADVLASEAGHKVQFFKGAREEKRKYLQLAQSNAQ
TALDAQYSQQKSVFARYLDLEAALEVDTPIQRMECFDISHTSGQQTVASCVVFKREGPHK
SDYRRYNIEGITPGDDYAAMAQALKRRYKSVKEVQKIPDLLLIDGGKGQLAQAEAFFEDW
PHDKKPMLLGVAKGTTRKPGLETLILAGSHQVLPMDSHSPGLHLIQHIRDESHRFAITGH
RNRRQKVKTTSSLESIPGIGAKRRQTLLKFMGGLQGLKKASKDEISNVPGISPELAETIY
DHLHQ