Protein Info for MIT1002_02147 in Alteromonas macleodii MIT1002

Annotation: putative thiol peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 PF00578: AhpC-TSA" amino acids 20 to 144 (125 residues), 65.7 bits, see alignment E=3.9e-22 PF08534: Redoxin" amino acids 20 to 161 (142 residues), 123.1 bits, see alignment E=8.3e-40

Best Hits

Swiss-Prot: 63% identical to TPX_COREF: Thiol peroxidase (tpx) from Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)

KEGG orthology group: K11065, thiol peroxidase, atypical 2-Cys peroxiredoxin [EC: 1.11.1.15] (inferred from 95% identity to amc:MADE_02074)

MetaCyc: 57% identical to lipid hydroperoxide peroxidase (Escherichia coli K-12 substr. MG1655)
1.11.1.15-RXN [EC: 1.11.1.24]

Predicted SEED Role

"Thiol peroxidase, Tpx-type (EC 1.11.1.15)" in subsystem Thioredoxin-disulfide reductase (EC 1.11.1.15)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (165 amino acids)

>MIT1002_02147 putative thiol peroxidase (Alteromonas macleodii MIT1002)
MASVTFQGNTVTTKGQLPEVGTSAPDFTLVKADLGEVTLSELAGKNVVLNIFPSIDTGTC
AMSVRKFNEEAAKLDNTTVICVSADLPFAAGRFCGAEGIENVLTGSTFRSSFGDDYGVTF
ESAPLTGLLSRSVVVIDAEGKVVYTEQVAETTEEPNYDAAIAALS