Protein Info for MIT1002_02136 in Alteromonas macleodii MIT1002

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 6 to 32 (27 residues), see Phobius details amino acids 52 to 70 (19 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 164 to 188 (25 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details PF13386: DsbD_2" amino acids 9 to 211 (203 residues), 181.8 bits, see alignment E=7.7e-58

Best Hits

KEGG orthology group: K09792, hypothetical protein (inferred from 89% identity to amc:MADE_02062)

Predicted SEED Role

"Heavy-metal-associated domain (N-terminus) and membrane-bounded cytochrome biogenesis cycZ-like domain, possible membrane copper tolerance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>MIT1002_02136 hypothetical protein (Alteromonas macleodii MIT1002)
MEGINYFSAFLIGLAGGVHCVGMCGGIVAALRMVSPKGASALPYTLAYNMGRIVSYTIAG
AVTGALGKIAADYIPLANYALSLLSGIMLLLLACYLGKWWTGLTVLENAGKGLFSKVQPL
SKRFLPFKTPLSALPYGFIWGWLPCGLVYSTLTWSLAAGNALEGAAIMFFFGLGTLPTLL
AASAGSQYIVRSFQHNHFRQIIAVIMAIYAAYLIHGAIV