Protein Info for MIT1002_02100 in Alteromonas macleodii MIT1002

Annotation: 2-hydroxyhexa-2,4-dienoate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03218: 4-oxalocrotonate decarboxylase
  • amino acids 3 to 262 (260 residues), 491.1 bits, E=3.6e-152
• PF01557: FAA_hydrolase
  • amino acids 105 to 261 (157 residues), 40.7 bits, E=1.1e-14

Best Hits

Swiss-Prot: 74% identical to XYLI_PSEPU: 4-oxalocrotonate decarboxylase (xylI) from Pseudomonas putida

KEGG orthology group: K01617, 4-oxalocrotonate decarboxylase [EC: 4.1.1.77] (inferred from 68% identity to lch:Lcho_3342)

MetaCyc: 74% identical to 4-oxalocrotonate decarboxylase subunit (Pseudomonas putida mt-2)
4-oxalocrotonate decarboxylase. [EC: 4.1.1.77]

Predicted SEED Role

"4-oxalocrotonate decarboxylase (EC 4.1.1.77)" in subsystem Benzoate transport and degradation cluster (EC 4.1.1.77)

MetaCyc Pathways

• catechol degradation II (meta-cleavage pathway) (7/7 steps found)
• catechol degradation to 2-hydroxypentadienoate II (4/4 steps found)
• meta cleavage pathway of aromatic compounds (8/10 steps found)
• protocatechuate degradation III (para-cleavage pathway) (4/5 steps found)
• 3-chlorocatechol degradation III (meta pathway) (3/4 steps found)
• 4-amino-3-hydroxybenzoate degradation (4/6 steps found)
• 2,3-dihydroxybenzoate degradation (3/5 steps found)
• orthanilate degradation (3/5 steps found)
• 2-amino-3-carboxymuconate semialdehyde degradation to 2-hydroxypentadienoate (2/4 steps found)
• 2-aminophenol degradation (2/4 steps found)
• toluene degradation IV (aerobic) (via catechol) (8/13 steps found)
• L-tryptophan degradation IX (7/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (7/12 steps found)
• 2-nitrobenzoate degradation I (2/7 steps found)
• 4-chloronitrobenzene degradation (3/9 steps found)
• 4-nitrotoluene degradation II (3/9 steps found)
• 2,2'-dihydroxybiphenyl degradation (2/10 steps found)
• superpathway of aerobic toluene degradation (11/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (14/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation
• Fluorene degradation
• Toluene and xylene degradation

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.77

Use Curated BLAST to search for 4.1.1.77

Protein Sequence (263 amino acids)

>MIT1002_02100 2-hydroxyhexa-2,4-dienoate hydratase (Alteromonas macleodii MIT1002)
MGNLNKQQIENLAEHLENAELQAHDVTKITDEFPDMTYEDAFDIQWEIRRRKEARGNKIV
GMKMGLTSWAKMAQMGVEHPCYGFLADYFSIPDGGEIKHDELIHPKVEAELAFVTKAPLQ
GPGIHIGDVLRATDFVMPAVEIIDSRYRDFKFDLKSVIADNSSSSRFVAGGNMAKPEDLD
LKNLGVVMEINGEVVQLGAGAAVLGHPASSVAMLANMLAERGEHIPAGTFIMIGAITAAV
SVKKGDNFTVRYQGLGTVSGKFV