Protein Info for MIT1002_02097 in Alteromonas macleodii MIT1002

Annotation: 2-hydroxypent-2,4-dienoate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03220: 2-oxopent-4-enoate hydratase
  • amino acids 5 to 260 (256 residues), 443.1 bits, E=1.5e-137
• PF01557: FAA_hydrolase
  • amino acids 71 to 259 (189 residues), 53.1 bits, E=1.7e-18

Best Hits

Swiss-Prot: 78% identical to XYLJ_PSEPU: 2-hydroxypent-2,4-dienoate hydratase (xylJ) from Pseudomonas putida

KEGG orthology group: None (inferred from 70% identity to rme:Rmet_1321)

MetaCyc: 78% identical to 2-oxopent-4-enoate hydratase subunit (Pseudomonas putida mt-2)
2-oxopent-4-enoate hydratase. [EC: 4.2.1.80]

Predicted SEED Role

"4-oxalocrotonate decarboxylase (EC 4.1.1.77)" in subsystem Benzoate transport and degradation cluster (EC 4.1.1.77)

MetaCyc Pathways

• catechol degradation II (meta-cleavage pathway) (7/7 steps found)
• catechol degradation I (meta-cleavage pathway) (5/5 steps found)
• catechol degradation to 2-hydroxypentadienoate II (4/4 steps found)
• 2-hydroxypenta-2,4-dienoate degradation (3/3 steps found)
• meta cleavage pathway of aromatic compounds (8/10 steps found)
• protocatechuate degradation III (para-cleavage pathway) (4/5 steps found)
• 3-chlorocatechol degradation III (meta pathway) (3/4 steps found)
• toluene degradation I (aerobic) (via o-cresol) (5/7 steps found)
• toluene degradation V (aerobic) (via toluene-cis-diol) (5/7 steps found)
• 4-amino-3-hydroxybenzoate degradation (4/6 steps found)
• 2,3-dihydroxybenzoate degradation (3/5 steps found)
• orthanilate degradation (3/5 steps found)
• 2-amino-3-carboxymuconate semialdehyde degradation to 2-hydroxypentadienoate (2/4 steps found)
• 2-aminophenol degradation (2/4 steps found)
• toluene degradation II (aerobic) (via 4-methylcatechol) (3/6 steps found)
• toluene degradation IV (aerobic) (via catechol) (8/13 steps found)
• L-tryptophan degradation IX (7/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (7/12 steps found)
• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (3/8 steps found)
• p-cumate degradation (3/8 steps found)
• 2-nitrobenzoate degradation I (2/7 steps found)
• 4-chloronitrobenzene degradation (3/9 steps found)
• 4-nitrotoluene degradation II (3/9 steps found)
• naphthalene degradation to acetyl-CoA (5/12 steps found)
• p-cymene degradation (3/11 steps found)
• 2,2'-dihydroxybiphenyl degradation (2/10 steps found)
• mandelate degradation to acetyl-CoA (6/18 steps found)
• superpathway of aerobic toluene degradation (11/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (9/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (14/42 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Carbazole degradation
• Ethylbenzene degradation
• Fluorene degradation
• Phenylalanine metabolism
• Styrene degradation
• Toluene and xylene degradation

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.77, 4.2.1.80

Use Curated BLAST to search for 4.1.1.77 or 4.2.1.80

Protein Sequence (261 amino acids)

>MIT1002_02097 2-hydroxypent-2,4-dienoate hydratase (Alteromonas macleodii MIT1002)
MNKDQIKACGDELYKALTQRKTLKPLTERFDDISIEDAYHISLQMVERRVQAGAKIIGKK
IGVTSKTVQNMLNVHQPDFGYLTHDMAYSQGEEMPISQKLIQPKAEGEIAFILKKDLIGP
GITNADVLAATDCVIPCFEVVDSRIESWNIKIQDTVADNASCGLFVLGDKAVSPSKVDLS
TCGMVVEKNGKIISTGAGAAALGSPVNCVTWLANTLGQFGISLKAGEVILSGSLVPLEPV
TAGDFMSVSIGGIGNASVRFV