Protein Info for MIT1002_02097 in Alteromonas macleodii MIT1002

Annotation: 2-hydroxypent-2,4-dienoate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 TIGR03220: 2-oxopent-4-enoate hydratase" amino acids 5 to 260 (256 residues), 443.1 bits, see alignment E=1.5e-137 PF01557: FAA_hydrolase" amino acids 71 to 259 (189 residues), 53.1 bits, see alignment E=1.7e-18

Best Hits

Swiss-Prot: 78% identical to XYLJ_PSEPU: 2-hydroxypent-2,4-dienoate hydratase (xylJ) from Pseudomonas putida

KEGG orthology group: None (inferred from 70% identity to rme:Rmet_1321)

MetaCyc: 78% identical to 2-oxopent-4-enoate hydratase subunit (Pseudomonas putida mt-2)
2-oxopent-4-enoate hydratase. [EC: 4.2.1.80]

Predicted SEED Role

"4-oxalocrotonate decarboxylase (EC 4.1.1.77)" in subsystem Benzoate transport and degradation cluster (EC 4.1.1.77)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.77, 4.2.1.80

Use Curated BLAST to search for 4.1.1.77 or 4.2.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>MIT1002_02097 2-hydroxypent-2,4-dienoate hydratase (Alteromonas macleodii MIT1002)
MNKDQIKACGDELYKALTQRKTLKPLTERFDDISIEDAYHISLQMVERRVQAGAKIIGKK
IGVTSKTVQNMLNVHQPDFGYLTHDMAYSQGEEMPISQKLIQPKAEGEIAFILKKDLIGP
GITNADVLAATDCVIPCFEVVDSRIESWNIKIQDTVADNASCGLFVLGDKAVSPSKVDLS
TCGMVVEKNGKIISTGAGAAALGSPVNCVTWLANTLGQFGISLKAGEVILSGSLVPLEPV
TAGDFMSVSIGGIGNASVRFV