Protein Info for MIT1002_02090 in Alteromonas macleodii MIT1002

Annotation: Toluene-4-monooxygenase system protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 transmembrane" amino acids 189 to 209 (21 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details PF02332: Phenol_Hydrox" amino acids 22 to 249 (228 residues), 243.6 bits, see alignment E=2.2e-76 PF04945: YHS" amino acids 421 to 449 (29 residues), 38 bits, see alignment (E = 1.4e-13)

Best Hits

Swiss-Prot: 76% identical to DMPN_PSEUF: Phenol hydroxylase P3 protein (dmpN) from Pseudomonas sp. (strain CF600)

KEGG orthology group: None (inferred from 76% identity to ppg:PputGB1_3308)

MetaCyc: 76% identical to phenol hydroxylase P3 component (Pseudomonas sp. CF600)

Predicted SEED Role

"Phenol hydroxylase, P3 oxygenase component DmpN (EC 1.14.13.7)" (EC 1.14.13.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.7

Use Curated BLAST to search for 1.14.13.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (510 amino acids)

>MIT1002_02090 Toluene-4-monooxygenase system protein A (Alteromonas macleodii MIT1002)
MTAAKKLNLKQKYQYLTRNMDWEPSYQKKSDIFPQEDFEGIKIVDWDGWEDPFRLTMDSY
WKYQAEKEKKLYAIFDAFAQNNGHQNISDARYVNSLKLFLTGVSPLEYAAFQGYSKVGRQ
FSGAGARVACQMQAIDELRHSQTQQHAMSHYNKHFNGLHDAPLMHDRVWFLSVPKSFFDD
ARSAGPFEFLTAISFSFEYVLTNLLFVPFMSGAAYNGDMATVTFGFSAQSDEARHMTLGL
EIIKFMLEQHEDNVPIVQKWIDKWFWRGFRLLSLVSMMMDYMLPNKVMSWQEAWEVYYEQ
SGGALFKELARYGIKPPKYQDVANAAKEHISHQLWTTFYQYGHATNFHTWIPKEEEMQWL
AEKYPNTFDKYYRPRLEHWDEQHKKGERFYNNTLPQLCQVCQVPVLFTKTEDPTSFSHCD
TVHEGERYHFCSEACGEIFEDEPAKYVQALLPVHQIYQGKSGGPELPQVLTDYYHINIGE
DNFDYVGSPDEKRWNEIKGIKPLNKDTDAA