Protein Info for MIT1002_02074 in Alteromonas macleodii MIT1002

Annotation: Staphylococcal respiratory response protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00072: Response_reg
  • amino acids 6 to 114 (109 residues), 89.7 bits, E=1.5e-29
• PF00486: Trans_reg_C
  • amino acids 152 to 228 (77 residues), 68.3 bits, E=5.1e-23

Best Hits

Swiss-Prot: 40% identical to CPXR_HAEIN: Transcriptional regulatory protein CpxR homolog (cpxR) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 62% identity to gag:Glaag_0942)

MetaCyc: 42% identical to DNA-binding transcriptional dual regulator CpxR (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Copper-sensing two-component system response regulator CpxR" in subsystem Orphan regulatory proteins

Protein Sequence (229 amino acids)

>MIT1002_02074 Staphylococcal respiratory response protein A (Alteromonas macleodii MIT1002)
MDATKILIIEDDITLNKQIAALLKDRGFDVHQCHDGNQGLVTALRERFDLILLDVLLPNL
NGFSLLSQLRKRKQTPVIMVTACGAEQERIKGYSNGADDYMPKPFSFVEMMLRIEALLRR
SLNVKSNEVTRNSIVVDEITLDRRNLKANFAGKALDLTSTQFKLLWVLLENQNEVLSKPL
LYQTVLERSFSRYDRSLDMHMSRVRKKLIEAGMSPTRLATQHGKGYLFS