Protein Info for MIT1002_02054 in Alteromonas macleodii MIT1002

Annotation: Cation efflux system protein CzcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1064 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 352 to 371 (20 residues), see Phobius details amino acids 378 to 398 (21 residues), see Phobius details amino acids 404 to 425 (22 residues), see Phobius details amino acids 475 to 495 (21 residues), see Phobius details amino acids 507 to 533 (27 residues), see Phobius details amino acids 562 to 581 (20 residues), see Phobius details amino acids 900 to 919 (20 residues), see Phobius details amino acids 926 to 945 (20 residues), see Phobius details amino acids 953 to 973 (21 residues), see Phobius details amino acids 1000 to 1017 (18 residues), see Phobius details amino acids 1029 to 1055 (27 residues), see Phobius details TIGR00914: heavy metal efflux pump, CzcA family" amino acids 1 to 1059 (1059 residues), 1057.7 bits, see alignment E=0 PF00873: ACR_tran" amino acids 6 to 1055 (1050 residues), 913.8 bits, see alignment E=1.3e-278 PF03176: MMPL" amino acids 850 to 1058 (209 residues), 22.9 bits, see alignment E=4e-09

Best Hits

KEGG orthology group: K07239, heavy-metal exporter, HME family (inferred from 99% identity to kko:Kkor_1264)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcA; Cation efflux system protein CusA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (1064 amino acids)

>MIT1002_02054 Cation efflux system protein CzcA (Alteromonas macleodii MIT1002)
MFNRIVDWAVTNRLLVAIALITLTVSAFFIIPRLNLDAFPDVTNVQVSVNTEAPGLAAEE
VEQLITYPIEAVMYALPDVEEVRSISKTGLSGVTVVFKEGTDIYFARQLVFERLQAAKEL
IPEGVGTPEMGPNTSGLGQVYQYLLVAEPGSGFDAMELRSLNDWVVKLLLIPAEGVTDVL
SFGGEVRQYQVDLNPSKLLSYDLTQDDIMAALERNNTNVGGWYMNRGQEQLVIRGTGWLD
HGKQGLEQIRQVPLKTVDGTTITVSDVAKVNLGSEIRQGAVTMTRRTSDGKVETLGEVVS
GIVLKRLGANTKSTIDGVNARIERINQALPEGVKFEAYYDQADLVTQAVDTVVNALLLAF
VFIVVILALFLMNLRATLLVLISIPISIGIALMVMAWFGLSANLMSLGGIAVAIGMLVDG
SVVMVENMFKHLTHPDATHDKDRQTMVQDDPDPVDAAHDSHGIALRLQEAGREVARPIFF
ATAIILVVFMPLFSFEGVEAKLFQPMAISIMLSMLSALVVALIIVPALATYLFRKGIRPR
ESFVLKPLDKLYRKGLSWAMSHSKVVVGIAVTLVVAAALVIPRLGTEFVPELEEGTVNLR
VTLAPSSSLDTALEVAPKLEAMLMEFPEVTYALSRIGRAEIGGDPEPVNNIEIYIGLKPV
PEWTSADNRYELQSLMEQKLEQHPGLLFNFSQPIATRVDELLSGVKAQLAIKLFGKDLDV
LAEKGQAIEAVVKKIDGTRDVAMEQIVGEAQLVVKPNRRALSRYGLDVADVMEVVRNGLG
GASAGQIINGNERYDIYVRLDERFRQDRETIADLRLQAPSGAWVRLGDVASVNIASGPPQ
VRRDDVQRRVVVQANVQGRDMGSVVADIRAAIAEQVDLPTGYSVDIGGQFENQQRAQKRL
SLVVPLSLALIALLLYFAFASVGQAMLILVNVPLAVIGGVFSLWLSGQYLSVPSSVGFIT
LFGVAVLNGVVMVESINQRIKDGLPVSEAAFDGAVSRLRPVLMTAVTSALGLIPMLLSNG
VGAEIQKPLASVIVGGLITATFLTLFVLPVLFAWFSKGKLKEKH