Protein Info for MIT1002_02048 in Alteromonas macleodii MIT1002

Annotation: N(2)-citryl-N(6)-acetyl-N(6)-hydroxylysine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 630 transmembrane" amino acids 549 to 566 (18 residues), see Phobius details PF04183: IucA_IucC" amino acids 157 to 378 (222 residues), 179.1 bits, see alignment E=1.1e-56 PF06276: FhuF" amino acids 426 to 587 (162 residues), 118.6 bits, see alignment E=4e-38

Best Hits

Predicted SEED Role

"Anthrachelin biosynthesis protein AsbA @ Siderophore synthetase superfamily, group A @ Siderophore synthetase large component, acetyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (630 amino acids)

>MIT1002_02048 N(2)-citryl-N(6)-acetyl-N(6)-hydroxylysine synthase (Alteromonas macleodii MIT1002)
MTSVAKKQANIASFQAFFNAYIKEIDSGVWHTKEDWVIRTGIQLQPNDNYAVELYLTSTN
TRLSISASYRSTVGRHAFTAVFKQLPNSFQWEEVSLMNAILLLIDEIYSGSKESHELNDA
VDEQSLELYARTIESHQIMALYLENRAGDPDLASNKFIDSEQAILFGHWLHPTPKSRQGM
HRWQHELFTPELKGQFRLHYFAAKQDITLSNSAESISAFEILEDIVLSDGKDSTKTLIEK
LRKDNLKLLALHPLQADWLCAKPHIQDLLNKGELIQLGELGPLFTPTSSVRTLYNAELNY
MVKLSIPVKVTNSLRKNMHHELEAGVTLCRLLQRCGFSRLYPKFKFIDDPAYISLNAGDS
KESGFELILRKNPFNSKNEITGLGGTQSIAALVQEPLAPGTYSRLAKIIQMLAQKEGEEC
ADVALTWFDNYLDCAIEPAIRLFDQCGIALEAHQQNSLLDLSEGYPTAYYYRDNQGFYLS
KERQQILETMEPRLAQCDDLFYGEQMIINRFTYYLFFNQLFAVINRLGADQLVQEGTLLQ
KVYTRLNSILPTLGSLGTAFVTSVLGREKLPFKANLLTRVEDVDELEAEDELAVYVWVTN
PFKSVAVRSDTPSLVCKQASELEEVIADAC