Protein Info for MIT1002_02044 in Alteromonas macleodii MIT1002

Annotation: Cryptochrome DASH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 TIGR02765: cryptochrome, DASH family" amino acids 16 to 435 (420 residues), 496.2 bits, see alignment E=4.1e-153 PF00875: DNA_photolyase" amino acids 18 to 181 (164 residues), 116.4 bits, see alignment E=1.4e-37 PF03441: FAD_binding_7" amino acids 291 to 435 (145 residues), 147.5 bits, see alignment E=3.5e-47

Best Hits

KEGG orthology group: K01669, deoxyribodipyrimidine photo-lyase [EC: 4.1.99.3] (inferred from 56% identity to alt:ambt_08115)

Predicted SEED Role

"Cryptochrome"

Isozymes

Compare fitness of predicted isozymes for: 4.1.99.3

Use Curated BLAST to search for 4.1.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>MIT1002_02044 Cryptochrome DASH (Alteromonas macleodii MIT1002)
MINHHQQTKRTNNNQRGLYWFRHDLRLHDNAAISALCEEVQQVTFLYILDDKAFTPTTYG
FAPMGKHRHTFLLQTLVDLKRQLAKLGHDLLIVKGDPAERLVQLMKSGQYSHLGVSEHCG
FDERAQLNTVKRFFDSVTVIETPTFGLFDAQTLPFNIKEMPDVFSPFRRKVEKHCKPLSV
HPPMESLPSPFTPQLDESFLFAIDTDLPSPSQSSFVGGETAALTHLNTYLFDWKAAATYK
DTRNALDTWQDSTKLSAWLANGSLSAREVIRQVQQFEATVEKNDSTYWIYFELLWREFFH
WLQCKYGANWFRFGGIQGKKPSTQHCPETFALWCEGKTGYPIVDACMRQLAETGYMSNRG
RQLVASCFVHELRQDWRFGAAWFEHQLIDYDVGSNWGNWLYLAGVGSDPRGHRQFNLQKQ
TEIYDSDGQFRKKWL