Protein Info for MIT1002_02017 in Alteromonas macleodii MIT1002

Annotation: Acyl-CoA thioesterase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 TIGR00189: acyl-CoA thioesterase II" amino acids 10 to 282 (273 residues), 301 bits, see alignment E=4.5e-94 PF13622: 4HBT_3" amino acids 24 to 107 (84 residues), 76.6 bits, see alignment E=2.2e-25 PF02551: Acyl_CoA_thio" amino acids 59 to 112 (54 residues), 25.3 bits, see alignment E=1.8e-09 amino acids 156 to 280 (125 residues), 119.6 bits, see alignment E=1.3e-38 PF20789: 4HBT_3C" amino acids 151 to 281 (131 residues), 89.2 bits, see alignment E=4.5e-29

Best Hits

KEGG orthology group: K10805, acyl-CoA thioesterase II [EC: 3.1.2.-] (inferred from 83% identity to alt:ambt_07990)

Predicted SEED Role

"Acyl-CoA thioesterase II (EC 3.1.2.-)" (EC 3.1.2.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>MIT1002_02017 Acyl-CoA thioesterase 2 (Alteromonas macleodii MIT1002)
MSEIKLSSLFELETVEAGIYRGQSWDLGFRALFGGQVLGQALAAAYETVEAGRVAHSFHT
YFLRPGDAKKPVVYDVEVVRDGRSFSARRVKAIQDGRNIFYMTASFQVPQDGMEHQNPTM
PDVPAPEDVQSDIEFYEANFNKIARPMQEALSYHKPVDIRTVDAANSYQSAKREPTRYIW
LKARDTMNASQTVHQAALAYASDYHFLSTSLQPHGVAVTDKSLRIATIDHAMWFHRPINM
NEWLLYAMESPFSGGSRGLVRGQIFNQNGELVASTMQEGLMRKVDE