Protein Info for MIT1002_02008 in Alteromonas macleodii MIT1002

Annotation: Para-aminobenzoate synthase component 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 PF04715: Anth_synt_I_N" amino acids 36 to 172 (137 residues), 72 bits, see alignment E=6e-24 TIGR00553: aminodeoxychorismate synthase, component I" amino acids 130 to 469 (340 residues), 357.1 bits, see alignment E=4.4e-111 PF00425: Chorismate_bind" amino acids 213 to 466 (254 residues), 297.7 bits, see alignment E=7.9e-93

Best Hits

KEGG orthology group: K01665, para-aminobenzoate synthetase component I [EC: 2.6.1.85] (inferred from 77% identity to amc:MADE_01948)

Predicted SEED Role

"Para-aminobenzoate synthase, aminase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis (EC 2.6.1.85)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85

Use Curated BLAST to search for 2.6.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (479 amino acids)

>MIT1002_02008 Para-aminobenzoate synthase component 1 (Alteromonas macleodii MIT1002)
MSHADTIHVHVSRFTAEELADKLALNCDENTAVFNALFKRVSTRPYSLLLDTSGSSKSEG
RFNIMAFSPSAVIEAKGDKVQLIELNTSKRQQLTLTPFEAVQAHLHARVSNVNIHASVNT
AHLPFIIGVAGMAGYDTGRFYETMPSIAKNDYETPDFAVGLYLRSLIEDTKTGYIYYCSV
DSQPLTQFFSSFNDETPEPKFKLTSRFESNLSKTEYEACLDKIHAYLRAGDCYQVNMAQR
FSAAFEGNMWQAYCELRNQNQAPFSAFYNLPQGCIASISPERFLRVKDGVVETKPIKGTR
PRFEDKAEDAASAQSLLSAEKDRAENLMIVDLLRNDISKHCKPHSVNVPALFALESYQAV
HHLVSTVTGELNESSSPLSLLASAFPGGSITGAPKIRAMEVIDELEPHRRNIYCGSVFYM
GFREDMDSSICIRTVLAENRRLHCWAGGGIVLDSVSSEEYQETLDKVSRILPVLESINQ