Protein Info for MIT1002_01961 in Alteromonas macleodii MIT1002

Annotation: putative transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 82 to 99 (18 residues), see Phobius details amino acids 104 to 129 (26 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 261 to 279 (19 residues), see Phobius details amino acids 320 to 340 (21 residues), see Phobius details amino acids 351 to 370 (20 residues), see Phobius details amino acids 393 to 415 (23 residues), see Phobius details amino acids 426 to 451 (26 residues), see Phobius details amino acids 460 to 479 (20 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 300 (284 residues), 63.6 bits, see alignment E=1.6e-21 amino acids 302 to 487 (186 residues), 52.6 bits, see alignment E=3.6e-18 PF13347: MFS_2" amino acids 41 to 217 (177 residues), 65.8 bits, see alignment E=2.9e-22

Best Hits

KEGG orthology group: None (inferred from 93% identity to amc:MADE_01889)

Predicted SEED Role

"Predicted maltose transporter MalT" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (493 amino acids)

>MIT1002_01961 putative transporter (Alteromonas macleodii MIT1002)
MQATQPRLSFWQIWNVSFGFLGVQFGFALQNANVSRILSDLGADLHSLSLFWLVAPIMGL
IVQPIVGSASDRTWNRLGRRRPFILAGAIAAVLGMILLPNAPIFVAFLAPMVMGALMVAL
MDASFNVCFQPFRSLVSDMVPPSQRNVGYSIQSLLINIGAVIGSILPFVLTNVIGLENTA
QMGEVAPSVVWAFYIGATVLLGTVIWTVVRTKEYAPDEYNRYKGLTEEQPATEKAPKAPL
GQRLSEFFTLVKDMPKTMKQLAVVQFFSWFALFIMWVYTTPAITQHIWNVDKQWFDPAYI
AAAPMVPETIIMAKGAAGDWVGILFAAYSVFAAIFSIFLAKLADKFGRKTVYASSLALGG
LSYVSFLLFQDLTMINVNLLITEVTVPLGAVKLLIPMVGVGIAWAAILAMPYAMLAGALP
ANKTGVYMGIFNFTVAAPQIVSGLTAGWILSSVFDNDAKYIIVVAGVSMLIGAVSVFFVN
EADKQEIEEAQGA