Protein Info for MIT1002_01946 in Alteromonas macleodii MIT1002

Annotation: Succinate dehydrogenase flavoprotein subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 590 TIGR01816: succinate dehydrogenase, flavoprotein subunit" amino acids 6 to 590 (585 residues), 908 bits, see alignment E=2e-277 PF00890: FAD_binding_2" amino acids 9 to 405 (397 residues), 403.8 bits, see alignment E=1.1e-124 TIGR01812: succinate dehydrogenase or fumarate reductase, flavoprotein subunit" amino acids 9 to 590 (582 residues), 793.2 bits, see alignment E=1.3e-242 PF02910: Succ_DH_flav_C" amino acids 463 to 590 (128 residues), 134.3 bits, see alignment E=2.6e-43

Best Hits

Swiss-Prot: 84% identical to SDHA_ECOL6: Succinate dehydrogenase flavoprotein subunit (sdhA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00239, succinate dehydrogenase flavoprotein subunit [EC: 1.3.99.1] (inferred from 99% identity to amc:MADE_01873)

MetaCyc: 84% identical to succinate:quinone oxidoreductase, FAD binding protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Succinate dehydrogenase flavoprotein subunit (EC 1.3.99.1)" in subsystem Serine-glyoxylate cycle or Succinate dehydrogenase or TCA Cycle (EC 1.3.99.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (590 amino acids)

>MIT1002_01946 Succinate dehydrogenase flavoprotein subunit (Alteromonas macleodii MIT1002)
MSLPVHEFDAVVIGAGGAGMRAALQISQSGKSCALLSKVFPTRSHTVSAQGGITVALGNS
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAIIEMENMGLPFSRFENGKIYQRPFG
GQSKNFGGEQGARTAAAADRTGHALLHLLYQQNVKNKTKVFSEWYALDLVKNQDGDVVGC
TAIDIESGEVVYFKSRAVVLATGGAGRIYASTTNAHINTGDGVGMALRAGVAVQDMEMWQ
FHPTGIAGAGTLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSMMTEIREG
RGCEGPWGTHIKLKLDHLGKDVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTNVDGQCLTVDENGNDKVVNGLFACGEIACVSVHGANRLGGNSLLDLVVFGRATGLHLG
KTLSEMAPTRDASESDLEASMTRFNRWENSEKGKGEDPVQIKKDLQKCMQLNFSVFREGE
AMAEGLKELSEIRERLKHARLDDKSADFNTQRIECLELDNLMETAYSTAVAANFRTESRG
AHSRFDFPDRDDDNWLCHSIYDPNTDKMLKREVNMAPKLREAFPPKVRSY