Protein Info for MIT1002_01936 in Alteromonas macleodii MIT1002

Annotation: Molybdopterin-synthase adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00899: ThiF
  • amino acids 12 to 257 (246 residues), 139.2 bits, E=1.2e-44
• PF13241: NAD_binding_7
  • amino acids 21 to 146 (126 residues), 23.5 bits, E=7.1e-09

Best Hits

Swiss-Prot: 59% identical to TCDA_ECOLI: tRNA threonylcarbamoyladenosine dehydratase (tcdA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to amc:MADE_01865)

MetaCyc: 59% identical to tRNA threonylcarbamoyladenosine dehydratase (Escherichia coli K-12 substr. MG1655)
RXN0-7115

Predicted SEED Role

"CsdL (EC-YgdL) protein of the HesA/MoeB/ThiF family, part of the CsdA-E-L sulfur transfer pathway"

Protein Sequence (258 amino acids)

>MIT1002_01936 Molybdopterin-synthase adenylyltransferase (Alteromonas macleodii MIT1002)
MSDDPRLGGIVRLYGAQQTNNLANSHVAVVGIGGVGSWTAEALARSGIGTITLIDLDDVC
VTNTNRQIHALSNTIGEAKVDAIASRIHLINPACKVKCIEDFVTPDNTATLLTKEMHAVV
DATDSIRAKAAMIAHCKRNKIPIVTVGGAGGQIDPTQVTKGDLAKTTQDPLAAKLRSELR
RNYNFSKNPKRRFGVECIYSTEQLRYPQPDGSVCYNKSAMEGGTRLDCAGGFGAVVTVTA
TFGMFAAASVINRLTGQK