Protein Info for MIT1002_01867 in Alteromonas macleodii MIT1002

Annotation: Phosphoglucosamine mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 PF02878: PGM_PMM_I" amino acids 4 to 135 (132 residues), 148.7 bits, see alignment E=1.7e-47 TIGR01455: phosphoglucosamine mutase" amino acids 7 to 443 (437 residues), 621.3 bits, see alignment E=4.3e-191 PF02879: PGM_PMM_II" amino acids 157 to 254 (98 residues), 66 bits, see alignment E=7.8e-22 PF02880: PGM_PMM_III" amino acids 258 to 366 (109 residues), 111.5 bits, see alignment E=5.1e-36 PF00408: PGM_PMM_IV" amino acids 373 to 440 (68 residues), 57 bits, see alignment E=3.4e-19

Best Hits

Swiss-Prot: 79% identical to GLMM_PSEA6: Phosphoglucosamine mutase (glmM) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 96% identity to amc:MADE_01688)

MetaCyc: 68% identical to phosphoglucosamine mutase (Escherichia coli K-12 substr. MG1655)
Phosphoglucosamine mutase. [EC: 5.4.2.10]

Predicted SEED Role

"Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 5.4.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>MIT1002_01867 Phosphoglucosamine mutase (Alteromonas macleodii MIT1002)
MTQRKYFGTDGIRGKVGESNINPEFVTKLGWAAGKVLAGRGTNKVLIGKDTRISGYMLES
SLEAGLSAAGINIGLLGPMPTPAIAYLTKTFRSEAGIVISASHNPFYDNGIKFFSAQGFK
LDDDIELAIEDMLERPMTCVASDKLGKATRINDAAGRYIEFCKGTFPSELSLTDLKIVVD
CAHGATYHIAPNVLRELGATVIELGTAPNGLNINDGVGATSMDAIVEKVKETGADLGFAL
DGDGDRIMMVDHLGNVLDGDQIVYIIARDALKNGKMQGGVVGTLMSNLGLENALSKLGVP
FARSNVGDRYVMELLQQKGWSIGGENSGHVLNLNMSSTGDGIVAGLQVLAAMLRSHMDLH
DLASGFEMYPQTLVNVRYANQEVDYLAHSNVQNAKKEAESALGKTGRVLLRKSGTEPLIR
VMVESNDESQSHKWAEHIAETVRNLAN