Protein Info for MIT1002_01855 in Alteromonas macleodii MIT1002

Annotation: DNA polymerase III subunit delta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 TIGR01128: DNA polymerase III, delta subunit" amino acids 16 to 327 (312 residues), 254.3 bits, see alignment E=8.8e-80 PF06144: DNA_pol3_delta" amino acids 20 to 131 (112 residues), 55.3 bits, see alignment E=1e-18 PF21694: DNA_pol3_delta_C" amino acids 212 to 315 (104 residues), 31.7 bits, see alignment E=2.1e-11 PF14840: DNA_pol3_delt_C" amino acids 214 to 333 (120 residues), 52.3 bits, see alignment E=1.1e-17

Best Hits

KEGG orthology group: K02340, DNA polymerase III subunit delta [EC: 2.7.7.7] (inferred from 93% identity to amc:MADE_01661)

Predicted SEED Role

"DNA polymerase III delta subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>MIT1002_01855 DNA polymerase III subunit delta (Alteromonas macleodii MIT1002)
MQIYPNQFSQDITKALRPCYLVFGDEPQQKFDVIEQIRAKAKTNGFEERIVLVAETGFNW
NQLIEATQSMSLFSSQQFIELELPTGKPGTEGSKMLQEVAASLNPDILLLVHGPKIGKDV
QRGKWFKVLDDLGASVLCYPLEGKQLNAWLNQQLNAHQLSVSASGAKMIADFCEGNMLAA
KQEIDKLALLYPHQSISDEQIEKAMVDQSRFNVFQLVDVMLSGDSTRCIKMLYRLESEGL
EPNIIIWALIREWEQLWKLKLAQQSGAPIQWQKFGIWRNRQGFYQSALNRLSVAQLEDIQ
KALTQSDHAFKQNVIARPYVEMCHLCMMFMGMDLREIPLLQA