Protein Info for MIT1002_01845 in Alteromonas macleodii MIT1002

Annotation: Lipoyl synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00510: lipoyl synthase
  • amino acids 22 to 319 (298 residues), 475.3 bits, E=3.9e-147
• PF16881: LIAS_N
  • amino acids 27 to 72 (46 residues), 36.2 bits, 6.9e-13
• PF04055: Radical_SAM
  • amino acids 87 to 251 (165 residues), 78.9 bits, E=5.1e-26

Best Hits

Swiss-Prot: 90% identical to LIPA_PSEA6: Lipoyl synthase (lipA) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K03644, lipoic acid synthetase [EC: 2.8.1.8] (inferred from 99% identity to amc:MADE_01649)

MetaCyc: 71% identical to lipoyl synthase (Escherichia coli K-12 substr. MG1655)
Lipoyl synthase. [EC: 2.8.1.8]

Predicted SEED Role

"Lipoate synthase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

• lipoate biosynthesis and incorporation I (2/2 steps found)
• lipoate biosynthesis and incorporation III (Bacillus) (2/3 steps found)
• lipoate biosynthesis and incorporation V (mammals) (2/3 steps found)
• lipoate biosynthesis and incorporation IV (yeast) (4/7 steps found)
• lipoate biosynthesis and incorporation II (1/3 steps found)

KEGG Metabolic Maps

• Lipoic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.8

Protein Sequence (320 amino acids)

>MIT1002_01845 Lipoyl synthase (Alteromonas macleodii MIT1002)
MSNARPQAGIKLRDDEKVKHIPVTIIPTEKEEMLRKPEWIKIKLPRTTEKIDHIKQTLRK
NNLHSVCEEASCPNLAECFNHGTATFMILGDICTRRCPFCDVAHGKPLPPSAEEPEKLAK
TIAEMNLRYVVITSVDRDDLRDGGAQHFVDCINAIREHSPTTTIEVLVPDFRGRMDRALE
IFKDGVPDVFNHNLETIPRLYRECRPGANYQWSLDLLKKFKAQHPDVMTKSGLMMGMGEE
NEEIQGVLDDLRAHNVDMLTLGQYLQPSRHHYPVKRYVHPKEFDALGDYAKEIGFTHAAC
GPMVRSSYHADQQAAGKEVK