Protein Info for MIT1002_01836 in Alteromonas macleodii MIT1002

Annotation: arginyl-tRNA-protein transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF04376: ATE_N" amino acids 10 to 79 (70 residues), 79.3 bits, see alignment E=3.1e-26 PF13480: Acetyltransf_6" amino acids 75 to 204 (130 residues), 25.6 bits, see alignment E=1.8e-09 PF04377: ATE_C" amino acids 100 to 223 (124 residues), 127.3 bits, see alignment E=7.9e-41

Best Hits

Swiss-Prot: 51% identical to BPT_PSEA6: Aspartate/glutamate leucyltransferase (bpt) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K00685, arginine-tRNA-protein transferase [EC: 2.3.2.8] (inferred from 82% identity to amc:MADE_01638)

Predicted SEED Role

"Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6)" in subsystem Protein degradation (EC 2.3.2.6)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.3.2.6

Use Curated BLAST to search for 2.3.2.6 or 2.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (240 amino acids)

>MIT1002_01836 arginyl-tRNA-protein transferase (Alteromonas macleodii MIT1002)
MKFGITQSFSCSYLPDEQEQLLVYAENNDFQAWRYSQLIQVGFRRSGEQIYRPHCPACKA
CKSVRIPVNAYTPSRSQKRLLKANQGFRVQLVSETKSTYYPLYERYITERHTDGSMYPPS
RTQFDNFVLCDWMTTHYLEAYDGDKLIAVAVTDVVDANEHMGALSALYTFFDPDYSSASL
GTWMILMQIEEARRLGHHYVYLGYYVEGCQKMSYKHKFLPFEQFSDNEWHLFSKNSKIPT