Protein Info for MIT1002_01835 in Alteromonas macleodii MIT1002

Annotation: Translation initiation factor IF-1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00008: translation initiation factor IF-1
  • amino acids 3 to 70 (68 residues), 131.3 bits, E=4.8e-43
• PF01176: eIF-1a
  • amino acids 7 to 70 (64 residues), 102.6 bits, E=3.5e-34

Best Hits

Swiss-Prot: 96% identical to IF1_PSEA6: Translation initiation factor IF-1 (infA) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K02518, translation initiation factor IF-1 (inferred from 90% identity to apl:APL_1228)

Predicted SEED Role

"Translation initiation factor 1"

Protein Sequence (72 amino acids)

>MIT1002_01835 Translation initiation factor IF-1 (Alteromonas macleodii MIT1002)
MAKEDCIEMEGTVLDTLPNTMFRVELENGHVVTAHISGKMRKNYIRILTGDKVTVEMTPY
DLTKGRIVYRAR