Protein Info for MIT1002_01803 in Alteromonas macleodii MIT1002

Annotation: Fluoroquinolones export ATP-binding proteinc/MT2762

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF00005: ABC_tran" amino acids 9 to 152 (144 residues), 101.6 bits, see alignment E=5.8e-33 PF13304: AAA_21" amino acids 120 to 183 (64 residues), 43.5 bits, see alignment E=3.9e-15

Best Hits

KEGG orthology group: K01990, ABC-2 type transport system ATP-binding protein (inferred from 94% identity to amc:MADE_01807)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>MIT1002_01803 Fluoroquinolones export ATP-binding proteinc/MT2762 (Alteromonas macleodii MIT1002)
MCVDDRTLLDNLNFNVGKGEVFALLGGNGAGKSTTLKTFLGLMKASSGSATVLGRNASTQ
PNQVQKSVAYLPESVTLYGHLSGVENIRYFLSVAGVDKSDDDMFAALRKVALQEDSWNKA
LSNYSKGMRQKTAIALALLRNAPVLFLDEPTSGLDPAAIDEFNALVSELAAGGATIFMVT
HDVYGACQVAHRIVLLSNGKLTGSFERAGDTPIDTEAVHAAFAGRNV