Protein Info for MIT1002_01802 in Alteromonas macleodii MIT1002

Annotation: gliding motility-associated ABC transporter permease protein GldF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 178 to 202 (25 residues), see Phobius details amino acids 208 to 233 (26 residues), see Phobius details amino acids 240 to 260 (21 residues), see Phobius details amino acids 453 to 475 (23 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 72 to 365 (294 residues), 67.6 bits, see alignment E=1.7e-22 PF12698: ABC2_membrane_3" amino acids 136 to 255 (120 residues), 41.1 bits, see alignment E=1.9e-14 PF12040: DUF3526" amino acids 280 to 441 (162 residues), 106.1 bits, see alignment E=3.9e-34

Best Hits

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 89% identity to amc:MADE_01806)

Predicted SEED Role

"FIG00952399: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (480 amino acids)

>MIT1002_01802 gliding motility-associated ABC transporter permease protein GldF (Alteromonas macleodii MIT1002)
MILNVAKIICAEQWRYWMRTKVAATVLLLGAMLTIAALVVNAFHIDEAAHTRDHLQTEAE
QRFEAQPDKHPHRMVHYGHYVFRAPTPLSVIEPGVDTYTGNAIFLEGHRQNSAMFAEQRQ
SAGLTRFSSLTPSFLALVLAPLFIILIGYGSVSREREAGTLTLLLSQGTSRWQLLLGKLL
ALITASSLFLLPLLLACLYVAFSNESALVVILFCLSYVVYFLLWATVVTACSAIFEKSSV
SFTVLVVIWMSACVLLPRLGSSVATNIAPSMGKLEADFKVEEKLRSLGDGHDVNDPAFKK
LKEDLLAKYNVDSVDDLPVNFRGIVAQYSEGRQAKVLNEFAETRMTEELEQAQIARQFGW
LSPTVAVRSISTILAGTSLETHHRFLREAETLRLEFVQALNKVHAEKLDYKLDMNRNASE
EAADKAVVGADNWAILAEFDFKPEAGSTRISNALIYFIQLLLWMGLTALLLQAAVRRLNP