Protein Info for MIT1002_01769 in Alteromonas macleodii MIT1002

Annotation: Ribosome maturation factor RimP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF02576: RimP_N" amino acids 11 to 83 (73 residues), 110.1 bits, see alignment E=5.5e-36 PF17384: DUF150_C" amino acids 86 to 151 (66 residues), 55.4 bits, see alignment E=5.9e-19

Best Hits

Swiss-Prot: 99% identical to RIMP_ALTMD: Ribosome maturation factor RimP (rimP) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K09748, ribosome maturation factor RimP (inferred from 98% identity to amc:MADE_01758)

Predicted SEED Role

"FIG000325: clustered with transcription termination protein NusA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (152 amino acids)

>MIT1002_01769 Ribosome maturation factor RimP (Alteromonas macleodii MIT1002)
MAKLEEKLTEMLEPGVEALGFELVGIEFVRAGKHSILRVFIDHENGITVDDCADVSHQVS
AILDVEDPISTEYNLEVSSPGMDRPLFKEKHYIESVGEVVQIRLSMPMDDRRNFKGKVLA
CENGIVSIEVDGQQFQLAVANIEKGNVVPTFD