Protein Info for MIT1002_01749 in Alteromonas macleodii MIT1002

Annotation: Haloalkane dehalogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF12146: Hydrolase_4" amino acids 48 to 166 (119 residues), 37.6 bits, see alignment E=2.4e-13 PF00561: Abhydrolase_1" amino acids 48 to 285 (238 residues), 84.8 bits, see alignment E=1.1e-27 PF12697: Abhydrolase_6" amino acids 49 to 291 (243 residues), 58.8 bits, see alignment E=1.9e-19

Best Hits

Swiss-Prot: 54% identical to DHMA_PSYCK: Haloalkane dehalogenase (dhmA) from Psychrobacter cryohalolentis (strain K5)

KEGG orthology group: K01563, haloalkane dehalogenase [EC: 3.8.1.5] (inferred from 82% identity to amc:MADE_02319)

Predicted SEED Role

"Hydrolase, alpha/beta fold family protein, At1g52510/AT4G12830 homolog, group4"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.8.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>MIT1002_01749 Haloalkane dehalogenase (Alteromonas macleodii MIT1002)
MQVLKTPESAFDTITDFPYSPCFTEVTDTVSSEITMAHYQCGPKDGHTVLLIHGEPTWAY
LYRKMMPILADAGFNVIAPDLIGFGRSDKPVRKEDYSYARHVIWLKDWFSQATKGPVTLF
CQDWGGLLGLRLVADMPERFSGVMVSNTGLPTGDHPPSDAFIKWRRFSQDVAVFPTSTII
QNATTTVLDEATLAAYDAPFPDESFKAGARMFPILVPTSPDNAEAQANRQAWEKLKQYNK
PFVTAFGDSDPVTKGGDKVFQKLIPGSSGMAHTLVENGGHFIQEDQGEMLAKLLIQFINQ
TQLK